Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectstropicalmeadow
Anethum graveolens or Dill from Herb
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Caterpillar and Buttefly from Caterpillar
Rhododendron Calendulaceum or Flame Azalea from Azalea
Orchids from Orchid
Flower Poppy from Red
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Common Buttercup Flower from Buttercup
Europeana Floribunda Rose from Roses
Pollinators of Alaska from Nps
Orchid Lycaste Aromatica from Orchid
Iris Motif from Iris
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Flower Blossom from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Black Elderberry from Elderberry
Double Delight Hybrid Tea Rose from Roses
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Daffodil from Daffodil
Swallow Tail Hummingbird from Hummingbirds
Butterfly from Cartoon animals viii coloring book
Apple Blossom Branch from Apple tree
Steampunk Bee from Steampunk animals coloring book
Bumblebee from Woodland animals
Cosmos Scabiosoides from Cosmos
Bee from Cartoon animals v coloring book
Bee from Cartoon animals viii coloring book
Spring Crocus from Crocus
Heliconia Indica from Heliconia
Common Fruit Bats from Realistic animals coloring book
Bug from Animals
Black Raspberry from Celebrating wildflowers coloring book
Butterfly from Cartoon animals vii coloring book
Hibiscus Flower from Hawaii flower
Cherokee Rose from Roses
Chinese Peony from Flowers
Hibiscus from Realistic flowers
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Simple objects coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Bumblebee from Bumblebee
Ladybug from Cartoon animals viii coloring book
Daisy from Simple objects iv coloring book
Realistic Sunflowers from Sunflower
Ladybug from Cartoon animals v coloring book
Hummingbird from Cartoon animals ii coloring book
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Viola Adunca or Pale Mountain Violet from Violet
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Daffodil Flowers from Daffodil
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Oriental poppy from Perennial
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Clarkia Amoena Farewell to Spring from Godetia
Schlumbergera Bloom from Cactus
Tropical Vanda Tricolor Orchid from Orchid
Common Evening Primrose or Evening Star from Primrose
Grasshopper on Flower from Grasshoppers
Grasshopper in Garden from Grasshoppers
Sundowner Rosa Grandiflora from Roses
Sophronitis Cernua Orchid from Orchid
Aster 1 from Asters
Cornflower from Cornflowers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Bluebell Bellflower from Bellflower
Heliconia Psittacorum from Heliconia
Ranunculus Acris from Buttercup
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Cornflower, Blue Bottle from Cornflowers
Aster or Star Plant from Asters
Butterfly Flies On A Flower from Flowers
Burke's Larkspur from Celebrating wildflowers coloring book
Scarlet Carnation from Carnation
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Big-Headed Clover from Celebrating wildflowers coloring book
Pink Hibiscus from Realistic flowers
Chrysanthemum Morifolium from Flower garden
Anemone Coronaria from Anemone
Daffodil from Daffodil
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Chrysanthemum Carinatum from Realistic flowers
Blooming Sunflower from Sunflower
Life Cycle of Monarch Butterfly from Biology
Wildflower from Plants ii coloring book
201 - 300 of 1,830 Next page
/ 19